NME1 polyclonal antibody, Rabbit

Product Overview

• Article Name: NME1 polyclonal antibody, Rabbit
• Biozol Catalog Number: ABN-PAB27463
• Supplier Catalog Number: PAB27463
• Alternative Catalog Number: ABN-PAB27463-100
• Manufacturer: Abnova
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein corresponding to amino acids of human NME1.
• Alternative Names: ABN-202409-10_Ab

Product Description

Rabbit polyclonal antibody raised against recombinant NME1.

Product Properties

• UniProt: 4830
• Buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Form: Liquid
• Sequence: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
• Target: NME1

Application Notes

• Application Dilute: Immunohistochemistry (1:20-1:50)Immunofluorescence (0.25-2 ug/mL)Western Blot (0.04-0.4 ug/mL)The optimal working dilution should be determined by the end user.