GLOD5 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB27465
Article Name: GLOD5 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB27465
Supplier Catalog Number: PAB27465
Alternative Catalog Number: ABN-PAB27465-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P
Species Reactivity: Human
Immunogen: Recombinant protein corresponding to amino acids of human GLOD5.
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant GLOD5.
UniProt: 392465
Buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Form: Liquid
Sequence: RRLDHIVMTVKSIKDTTMFYSKILGMEVMTFKEDRKALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNY
Target: GLOD5
Application Dilute: Immunohistochemistry (1:50-1:200)Immunofluorescence (1-4 ug/mL)The optimal working dilution should be determined by the end user.