TMPRSS2 polyclonal antibody, Rabbit

Catalog Number: ABN-PAB31839
Article Name: TMPRSS2 polyclonal antibody, Rabbit
Biozol Catalog Number: ABN-PAB31839
Supplier Catalog Number: PAB31839
Alternative Catalog Number: ABN-PAB31839-100
Manufacturer: Abnova
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Alternative Names: ABN-202409-10_Ab
Rabbit polyclonal antibody raised against recombinant human TMPRSS2.
UniProt: 7113
Buffer: In PBS, pH7.2 (40% glycerol, 0.02% sodium azide).
Form: Liquid
Sequence: GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
Target: TMPRSS2
Application Dilute: Immunohistochemistry (1:200 - 1:500)Western Blot (0.04-0.4 ug/mL)The optimal working dilution should be determined by the end user.