Anti-EIF2C1/AGO1 Picoband Antibody, Rabbit, Polyclonal

Catalog Number: ABT-ABO10115
Article Name: Anti-EIF2C1/AGO1 Picoband Antibody, Rabbit, Polyclonal
Biozol Catalog Number: ABT-ABO10115
Supplier Catalog Number: ABO10115
Alternative Catalog Number: ABT-ABO10115-100UG
Manufacturer: Abcepta
Host: Rabbit
Category: Antikörper
Application: WB, IHC-P
Species Reactivity: Human, Rat, Mouse
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EIF2C1/AGO1 (376-409aa EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR), identical to the related mouse and rat sequences.
Alternative Names: Protein argonaute-1, Argonaute1, hAgo1, Argonaute RISC catalytic component 1, Eukaryotic translation initiation factor 2C 1, eIF-2C 1, eIF2C 1, Putative RNA-binding protein Q99, AGO1, EIF2C1
Rabbit IgG polyclonal antibody for Protein argonaute-1(AGO1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Clonality: Polyclonal
Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molecular Weight: 97214
Antibody Type: Polyclonal Antibody
Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.