Anti-HnRNP A1 Picoband Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-HnRNP A1 Picoband Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: ABT-ABO10189
• Supplier Catalog Number: ABO10189
• Alternative Catalog Number: ABT-ABO10189-100UG
• Manufacturer: Abcepta
• Host: Rabbit
• Category: Antikörper
• Application: WB, IHC-P
• Species Reactivity: Human, Rat, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.
• Alternative Names: Heterogeneous nuclear ribonucleoprotein A1, hnRNP A1, Helix-destabilizing protein, Single-strand RNA-binding protein, hnRNP core protein A1, Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed, HNRNPA1, HNRPA1

Product Description

Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Product Properties

• Clonality: Polyclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molecular Weight: 38747
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Images