Anti-RPS6 Picoband Antibody, Rabbit, Polyclonal

Catalog Number: ABT-ABO10194
Article Name: Anti-RPS6 Picoband Antibody, Rabbit, Polyclonal
Biozol Catalog Number: ABT-ABO10194
Supplier Catalog Number: ABO10194
Alternative Catalog Number: ABT-ABO10194-100UG
Manufacturer: Abcepta
Host: Rabbit
Category: Antikörper
Application: WB, IHC-P
Species Reactivity: Human, Rat, Mouse
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.
Alternative Names: 40S ribosomal protein S6, Phosphoprotein NP33, RPS6
Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Clonality: Polyclonal
Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molecular Weight: 28681
Antibody Type: Polyclonal Antibody
Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.