A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.
Alternative Names:
40S ribosomal protein S6, Phosphoprotein NP33, RPS6
Rabbit IgG polyclonal antibody for 40S ribosomal protein S6(RPS6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Clonality:
Polyclonal
Concentration:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molecular Weight:
28681
Antibody Type:
Polyclonal Antibody
Application Notes:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
* VAT and and shipping costs not included. Errors and price changes excepted