Anti-CHRNA5 Picoband Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CHRNA5 Picoband Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: ABT-ABO10244
• Supplier Catalog Number: ABO10244
• Alternative Catalog Number: ABT-ABO10244-100UG
• Manufacturer: Abcepta
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CHRNA5 (44-76aa AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
• Alternative Names: Neuronal acetylcholine receptor subunit alpha-5, CHRNA5, NACHRA5

Product Description

Rabbit IgG polyclonal antibody for Neuronal acetylcholine receptor subunit alpha-5(CHRNA5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Product Properties

• Clonality: Polyclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molecular Weight: 53054
• NCBI: 1138
• UniProt: P30532
• Form: Lyophilized
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Images