Anti-EBP1 Picoband Antibody, Rabbit, Polyclonal
Catalog Number:
ABT-ABO10259
- Images (4)
| Article Name: | Anti-EBP1 Picoband Antibody, Rabbit, Polyclonal |
| Biozol Catalog Number: | ABT-ABO10259 |
| Supplier Catalog Number: | ABO10259 |
| Alternative Catalog Number: | ABT-ABO10259-100UG |
| Manufacturer: | Abcepta |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB, IHC-P |
| Species Reactivity: | Human, Rat, Mouse |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences. |
| Alternative Names: | Proliferation-associated protein 2G4, Cell cycle protein p38-2G4 homolog, hG4-1, ErbB3-binding protein 1, PA2G4, EBP1 |
| Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Tested with WB, IHC-P in Human,Mouse,Rat. |
| Clonality: | Polyclonal |
| Concentration: | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Molecular Weight: | 43787 |
| Antibody Type: | Polyclonal Antibody |
| Application Notes: | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|
|
|
|
|
|
|
|
|
|
|
Product Guarantee and Expert Support
