A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN), identical to the related mouse and rat sequences.
Alternative Names:
Proliferation-associated protein 2G4, Cell cycle protein p38-2G4 homolog, hG4-1, ErbB3-binding protein 1, PA2G4, EBP1
Rabbit IgG polyclonal antibody for Proliferation-associated protein 2G4(PA2G4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Clonality:
Polyclonal
Concentration:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molecular Weight:
43787
Antibody Type:
Polyclonal Antibody
Application Notes:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
* VAT and and shipping costs not included. Errors and price changes excepted