Anti-GAD65 Picoband Antibody, Rabbit, Polyclonal

Catalog Number: ABT-ABO10278
Article Name: Anti-GAD65 Picoband Antibody, Rabbit, Polyclonal
Biozol Catalog Number: ABT-ABO10278
Supplier Catalog Number: ABO10278
Alternative Catalog Number: ABT-ABO10278-100UG
Manufacturer: Abcepta
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.
Alternative Names: Glutamate decarboxylase 2, 4.1.1.15, 65 kDa glutamic acid decarboxylase, GAD-65, Glutamate decarboxylase 65 kDa isoform, GAD2, GAD65
Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Clonality: Polyclonal
Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Molecular Weight: 65411
NCBI: 2572
UniProt: Q05329
Form: Lyophilized
Antibody Type: Polyclonal Antibody
Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.