Anti-MMP11 Picoband Antibody, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MMP11 Picoband Antibody, Rabbit, Polyclonal
• Biozol Catalog Number: ABT-ABO10308
• Supplier Catalog Number: ABO10308
• Alternative Catalog Number: ABT-ABO10308-100UG
• Manufacturer: Abcepta
• Host: Rabbit
• Category: Antikörper
• Application: IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP11 (104-135aa RWEKTDLTYRILRFPWQLVQEQVRQTMAEALK), different from the related mouse and rat sequences by three amino acids.
• Alternative Names: Stromelysin-3, SL-3, ST3, 3.4.24.-, Matrix metalloproteinase-11, MMP-11, MMP11, STMY3

Product Description

Rabbit IgG polyclonal antibody for Stromelysin-3(MMP11) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Product Properties

• Clonality: Polyclonal
• Concentration: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Molecular Weight: 54590
• NCBI: 4320
• UniProt: P24347
• Form: Lyophilized
• Antibody Type: Polyclonal Antibody

Application Notes

• Application Notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Images