Anti-SUR2B Antibody, IgG2b, Clone: [N323B/20], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-SUR2B Antibody, IgG2b, Clone: [N323B/20], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ANI-73-399
• Supplier Catalog Number: 73-399
• Alternative Catalog Number: ANI-73-399
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
• Conjugation: Unconjugated
• Alternative Names: ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)

Product Description

Sulfonylurea receptor 2B (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR

Product Properties

• Clonality: Monoclonal
• Concentration: Lot dependent
• Clone Designation: [N323B/20]
• Molecular Weight: 175 kDa (and smaller fragments likely due to proteolytic cleavage)
• Isotype: IgG2b
• UniProt: Q63563
• Buffer: Supernatant is provided in cell culture medium with 0.1% sodium azide as anti-microbial
• Purity: TC Supernatant
• Form: Liquid
• Target: SUR2B
• Antibody Type: Primary Antibody