Anti-GluA2/GluR2 Glutamate Receptor Antibody, IgG1, Clone: [L21/32], Unconjugated, Mouse, Monoclonal

Catalog Number: ANI-75-002
Article Name: Anti-GluA2/GluR2 Glutamate Receptor Antibody, IgG1, Clone: [L21/32], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ANI-75-002
Supplier Catalog Number: 75-002
Alternative Catalog Number: ANI-75-002
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: EM, ICC, IHC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
Conjugation: Unconjugated
Alternative Names: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is
GluA2/GluR2 glutamate receptor, IgG1, Clone: L21/32, Mouse, Monoclonal
Clonality: Monoclonal
Concentration: 1 mg/mL
Clone Designation: [L21/32]
Molecular Weight: 90 kDa
Isotype: IgG1
UniProt: P19491
Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.4
Purity: Purified by Protein A chromatography
Form: Liquid
Target: GluA2/GluR2 glutamate receptor
Antibody Type: Primary Antibody
Application Dilute: Dilution Range: WB: 1:500. Dilution Range: IHC: 1:250. Dilution Range: ICC: 1:500