Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is