Anti-GluA2/GluR2 Glutamate Receptor Antibody FL650 Conjugate, IgG1, Clone: [L21/32], Mouse, Monoclonal

Product Overview

• Article Name: Anti-GluA2/GluR2 Glutamate Receptor Antibody FL650 Conjugate, IgG1, Clone: [L21/32], Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-002-FL650
• Supplier Catalog Number: 75-002-FL650
• Alternative Catalog Number: ANI-75-002-FL650
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
• Conjugation: FL650
• Alternative Names: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Product Description

Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is

Product Properties

• Clonality: Monoclonal
• Concentration: 0.5 mg/mL
• Clone Designation: [L21/32]
• Molecular Weight: 90 kDa
• Isotype: IgG1
• UniProt: P19491
• Buffer: PBS with 0.09% azide
• Purity: Purified by Protein A chromatography
• Form: Liquid
• Target: GluA2/GluR2 glutamate receptor
• Antibody Type: Primary Antibody