Anti-SUR1 Antibody FL550 Conjugate, IgG1, Clone: [N289/16], Mouse, Monoclonal

Catalog Number: ANI-75-267-FL550
Article Name: Anti-SUR1 Antibody FL550 Conjugate, IgG1, Clone: [N289/16], Mouse, Monoclonal
Biozol Catalog Number: ANI-75-267-FL550
Supplier Catalog Number: 75-267-FL550
Alternative Catalog Number: ANI-75-267-FL550
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Hamster, Mouse, Rat
Immunogen: Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (accession number Q09429) produced recombinantly in E. Coli
Conjugation: FL550
Alternative Names: ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)
Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KC
Clonality: Monoclonal
Concentration: 0.5 mg/mL
Clone Designation: [N289/16]
Molecular Weight: 180 kDa
Isotype: IgG1
UniProt: Q09429
Buffer: PBS with 0.09% azide
Purity: Purified by Protein A chromatography
Form: Liquid
Target: SUR1
Antibody Type: Primary Antibody