Anti-SUR1 Antibody FL594 Conjugate, IgG1, Clone: [N289/16], Mouse, Monoclonal

Product Overview

• Article Name: Anti-SUR1 Antibody FL594 Conjugate, IgG1, Clone: [N289/16], Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-267-FL594
• Supplier Catalog Number: 75-267-FL594
• Alternative Catalog Number: ANI-75-267-FL594
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Hamster, Mouse, Rat
• Immunogen: Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (accession number Q09429) produced recombinantly in E. Coli
• Conjugation: FL594
• Alternative Names: ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)

Product Description

Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KC

Product Properties

• Clonality: Monoclonal
• Concentration: 0.5 mg/mL
• Clone Designation: [N289/16]
• Molecular Weight: 180 kDa
• Isotype: IgG1
• UniProt: Q09429
• Buffer: PBS with 0.09% azide
• Purity: Purified by Protein A chromatography
• Form: Liquid
• Target: SUR1
• Antibody Type: Primary Antibody