Anti-SUR2A Antibody, IgG2a, Clone: [N319A/14], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-SUR2A Antibody, IgG2a, Clone: [N319A/14], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-296
• Supplier Catalog Number: 75-296
• Alternative Catalog Number: ANI-75-296
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Rat and Mouse
• Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (accession number P70170) produced recombinantly in E. Coli
• Conjugation: Unconjugated
• Alternative Names: ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)

Product Description

Sulfonylurea receptor 2A (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR

Additional Information

SUR2A, IgG2a, Clone: N319A/14, Mouse, Monoclonal

Product Properties

• Clonality: Monoclonal
• Concentration: 1 mg/mL
• Clone Designation: [N319A/14]
• Molecular Weight: 120 kDa
• Isotype: IgG2a
• UniProt: P70170
• Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
• Purity: Purified by Protein A chromatography
• Form: Liquid
• Target: SUR2A
• Antibody Type: Primary Antibody