Anti-SUR1 and SUR2B Antibody FL550 Conjugate, IgG1, Clone: [N323A/31], Mouse, Monoclonal

Catalog Number: ANI-75-298-FL550
Article Name: Anti-SUR1 and SUR2B Antibody FL550 Conjugate, IgG1, Clone: [N323A/31], Mouse, Monoclonal
Biozol Catalog Number: ANI-75-298-FL550
Supplier Catalog Number: 75-298-FL550
Alternative Catalog Number: ANI-75-298-FL550
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Rat and Mouse
Immunogen: Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
Conjugation: FL550
Alternative Names: ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
SUR1 and SUR2B are members of the ATP binding cassette transporter subfamily C. These proteins combine with KCNJ8(Kir6.1) or KCNJ11(Kir6.2) to form K+ATP channels and are involved in their regulation and activation.
Clonality: Monoclonal
Concentration: 0.5 mg/mL
Clone Designation: [N323A/31]
Molecular Weight: 175 kDa (and smaller fragments likely due to proteolytic cleavage)
Isotype: IgG1
UniProt: Q63563
Buffer: PBS with 0.09% azide
Purity: Purified by Protein A chromatography
Form: Liquid
Target: SUR1 and SUR2B
Antibody Type: Primary Antibody