Anti-BAF53b Antibody, IgG1, Clone: [N332B/15], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-BAF53b Antibody, IgG1, Clone: [N332B/15], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-311
• Supplier Catalog Number: 75-311
• Alternative Catalog Number: ANI-75-311
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
• Conjugation: Unconjugated
• Alternative Names: Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)

Product Description

Actin Like 6B, of BAFcomplex 53 KDa Subunit (BAF53b) is encoded by the gene ACTL6B and is a member of actin-related proteins family. It is a subunit of the neuron specific chromatin remodeling complex (nBAF complex). ACTL6B plays a role in remodeling mon

Additional Information

BAF53b, IgG1, Clone: N332B/15, Mouse, Monoclonal

Product Properties

• Clonality: Monoclonal
• Concentration: 1 mg/mL
• Clone Designation: [N332B/15]
• Molecular Weight: 53 kDa
• Isotype: IgG1
• UniProt: O94805
• Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
• Purity: Purified by Protein A chromatography
• Form: Liquid
• Target: BAF53b
• Antibody Type: Primary Antibody