Anti-BAF53b Antibody FL490 Conjugate, IgG1, Clone: [N332B/15], Mouse, Monoclonal

Catalog Number: ANI-75-311-FL490
Article Name: Anti-BAF53b Antibody FL490 Conjugate, IgG1, Clone: [N332B/15], Mouse, Monoclonal
Biozol Catalog Number: ANI-75-311-FL490
Supplier Catalog Number: 75-311-FL490
Alternative Catalog Number: ANI-75-311-FL490
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
Conjugation: FL490
Alternative Names: Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)
Actin Like 6B, of BAFcomplex 53 KDa Subunit (BAF53b) is encoded by the gene ACTL6B and is a member of actin-related proteins family. It is a subunit of the neuron specific chromatin remodeling complex (nBAF complex). ACTL6B plays a role in remodeling mon
Clonality: Monoclonal
Concentration: 0.5 mg/mL
Clone Designation: [N332B/15]
Molecular Weight: 53 kDa
Isotype: IgG1
UniProt: O94805
Buffer: PBS with 0.09% azide
Purity: Purified by Protein A chromatography
Form: Liquid
Target: BAF53b
Antibody Type: Primary Antibody