Anti-REEP1 Antibody FL490 Conjugate, IgG2b, Clone: [N345/51], Mouse, Monoclonal

Catalog Number: ANI-75-313-FL490
Article Name: Anti-REEP1 Antibody FL490 Conjugate, IgG2b, Clone: [N345/51], Mouse, Monoclonal
Biozol Catalog Number: ANI-75-313-FL490
Supplier Catalog Number: 75-313-FL490
Alternative Catalog Number: ANI-75-313-FL490
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Rat and Mouse
Immunogen: Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
Conjugation: FL490
Alternative Names: Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
Receptor expression-enhancing protein 1, Receptor Accessory Protein 1 or REEP1 is encoded by the gene REEP1. The REEP protein family is made up of six REEP proteins 1-6. REEP1 is a mitochondrial protein that links ER tubules to the cytoskeleton and is in
Clonality: Monoclonal
Concentration: 0.5 mg/mL
Clone Designation: [N345/51]
Molecular Weight: 22 kDa
Isotype: IgG2b
UniProt: Q8BGH4
Buffer: PBS with 0.09% azide
Purity: Purified by Protein A chromatography
Form: Liquid
Target: REEP1
Antibody Type: Primary Antibody