Anti-Kv1.2 Potassium Channel Subunit Antibody FL650 Conjugate, IgG2a, Clone: [L76/36], Mouse, Monoclonal

Product Overview

• Article Name: Anti-Kv1.2 Potassium Channel Subunit Antibody FL650 Conjugate, IgG2a, Clone: [L76/36], Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-314-FL650
• Supplier Catalog Number: 75-314-FL650
• Alternative Catalog Number: ANI-75-314-FL650
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (accession number P16389) produced recombinantly in E. Coli
• Conjugation: FL650
• Alternative Names: Potassium voltage-gated channel subfamily A member 2 (NGK1) (Voltage-gated K(+) channel HuKIV) (Voltage-gated potassium channel HBK5) (Voltage-gated potassium channel subunit Kv1.2)

Product Description

Potassium voltage-gated channel subfamily A member 2 (also known as Potassium Voltage-Gated Channel A Member 2 , Shaker-Related Subfamily, Member 2 or Voltage-Gated Potassium Channel Protein Kv1.2, or KCNA2) is a member of the Kv family of potassium chan

Product Properties

• Clonality: Monoclonal
• Concentration: 0.5 mg/mL
• Clone Designation: [L76/36]
• Molecular Weight: 80 kDa
• Isotype: IgG2a
• UniProt: P16389
• Buffer: PBS with 0.09% azide
• Purity: Purified by Protein A chromatography
• Form: Liquid
• Target: Kv1.2 potassium channel subunit
• Antibody Type: Primary Antibody