Anti-SVOP Antibody FL550 Conjugate, IgG1, Clone: [N356/23], Mouse, Monoclonal

Product Overview

• Article Name: Anti-SVOP Antibody FL550 Conjugate, IgG1, Clone: [N356/23], Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-353-FL550
• Supplier Catalog Number: 75-353-FL550
• Alternative Catalog Number: ANI-75-353-FL550
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC
• Species Reactivity: Rat and Mouse
• Immunogen: Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (accession number Q9Z2I7) produced recombinantly in E. Coli
• Conjugation: FL550
• Alternative Names: Synaptic vesicle 2-related protein (SV2-related protein)

Product Description

Synaptic vesicle 2-related protein or SVOP is encoded by the gene SVOP. SVOP contains 12 transmembrane regions and has transporter and ion transmembrane transporter activity. SVOP is expressed early in development and expressed in brain and endocrine cel

Product Properties

• Clonality: Monoclonal
• Concentration: 0.5 mg/mL
• Clone Designation: [N356/23]
• Molecular Weight: 60 kDa
• Isotype: IgG1
• UniProt: Q9Z2I7
• Buffer: PBS with 0.09% azide
• Purity: Purified by Protein A chromatography
• Form: Liquid
• Target: SVOP
• Antibody Type: Primary Antibody