Anti-Kir6.2 Potassium Channel Antibody FL550 Conjugate, IgG1, Clone: [N363/71], Mouse, Monoclonal

Product Overview

• Article Name: Anti-Kir6.2 Potassium Channel Antibody FL550 Conjugate, IgG1, Clone: [N363/71], Mouse, Monoclonal
• Biozol Catalog Number: ANI-75-393-FL550
• Supplier Catalog Number: 75-393-FL550
• Alternative Catalog Number: ANI-75-393-FL550
• Manufacturer: Antibodies Incorporated
• Host: Mouse
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Rat and Mouse
• Immunogen: Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS, cytoplasmic C-terminus) of rat Kir6.2 (accession number P70673) produced recombinantly in E. Coli
• Conjugation: FL550
• Alternative Names: ATP-sensitive inward rectifier potassium channel 11 (BIR) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11)

Product Description

ATP-sensitive inward rectifier potassium channel 11 or Kir6.2 is encoded by the gene KCNJ11. Kir6.2 is an integral membrane protein which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins

Product Properties

• Clonality: Monoclonal
• Concentration: 0.5 mg/mL
• Clone Designation: [N363/71]
• Molecular Weight: 45 kDa
• Isotype: IgG1
• UniProt: P70673
• Buffer: PBS with 0.09% azide
• Purity: Purified by Protein A chromatography
• Form: Liquid
• Target: Kir6.2 potassium channel
• Antibody Type: Primary Antibody