Anti-Kir6.2 Potassium Channel Antibody FL650 Conjugate, IgG1, Clone: [N363/71], Mouse, Monoclonal

Catalog Number: ANI-75-393-FL650
Article Name: Anti-Kir6.2 Potassium Channel Antibody FL650 Conjugate, IgG1, Clone: [N363/71], Mouse, Monoclonal
Biozol Catalog Number: ANI-75-393-FL650
Supplier Catalog Number: 75-393-FL650
Alternative Catalog Number: ANI-75-393-FL650
Manufacturer: Antibodies Incorporated
Host: Mouse
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Rat and Mouse
Immunogen: Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS, cytoplasmic C-terminus) of rat Kir6.2 (accession number P70673) produced recombinantly in E. Coli
Conjugation: FL650
Alternative Names: ATP-sensitive inward rectifier potassium channel 11 (BIR) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11)
ATP-sensitive inward rectifier potassium channel 11 or Kir6.2 is encoded by the gene KCNJ11. Kir6.2 is an integral membrane protein which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins
Clonality: Monoclonal
Concentration: 0.5 mg/mL
Clone Designation: [N363/71]
Molecular Weight: 45 kDa
Isotype: IgG1
UniProt: P70673
Buffer: PBS with 0.09% azide
Purity: Purified by Protein A chromatography
Form: Liquid
Target: Kir6.2 potassium channel
Antibody Type: Primary Antibody