RUVBL2 Antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: RUVBL2 Antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ASB-OAAN00599
• Supplier Catalog Number: OAAN00599
• Alternative Catalog Number: ASB-OAAN00599-100UL,ASB-OAAN00599-200UL,ASB-OAAN00599-50UL
• Manufacturer: Aviva
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC, IP, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-463 of human RUVBL2 (NP_006657.1).
• Conjugation: Unconjugated
• Alternative Names: RVB2, TIH2, ECP51, TIP48, CGI-46, ECP-51, INO80J, REPTIN, TIP49B, TAP54-beta

Product Description

This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 51 kDa
• NCBI: 10856
• UniProt: Q9Y230
• Form: Liquid PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
• Sequence: MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRT

Images

Immunofluorescence analysis of U20S cell using RUVBL2 antibody. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of MCF-7 cell using RUVBL2 antibody. Blue: DAPI for nuclear staining.

Western blot analysis of extracts of various cell lines, us