TREX1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ASB-OAAN02009
Article Name: TREX1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ASB-OAAN02009
Supplier Catalog Number: OAAN02009
Alternative Catalog Number: ASB-OAAN02009-100UL,ASB-OAAN02009-200UL,ASB-OAAN02009-50UL
Manufacturer: Aviva
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human TREX1 (NP_057465.1).
Conjugation: Unconjugated
Alternative Names: CRV, AGS1, DRN3, HERNS, RVCLS
This gene encodes a nuclear protein with 3 exonuclease activity. The encoded protein may play a role in DNA repair and serve as a proofreading function for DNA polymerase. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, Cree
Clonality: Polyclonal
Molecular Weight: 33 kDa
NCBI: 11277
UniProt: Q9NSU2
Form: LiquidPBS with 0.02% sodium azide, 50% glycerol (pH 7.3)
Sequence: MGPGARRQGRIVQGRPEMCFCPPPTPLPPLRILTLGTHTPTPCSSPGSAAGTYPTMGSQALPPGPMQTLIFFDMEATGLPFSQPKVTELCLLAVHRCALESPPTSQGPPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLLQAELAMLGLTSALDGAFCVDSITALKALERASSPSEHGPRKSYSLGSIYTRLYGQSPPDSHTAEG
Immunofluorescence analysis of A549 cell using TREX1 antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cell using TREX1 antibody.
Western blot analysis of extracts of various cell lines, using TREX1 antibody.