GALE Recombinant Protein, Human

Catalog Number: ASB-OPCA02229
Article Name: GALE Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02229
Supplier Catalog Number: OPCA02229
Alternative Catalog Number: ASB-OPCA02229-100UG,ASB-OPCA02229-1MG,ASB-OPCA02229-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: epididymis secretory sperm binding protein,galactose-4-epimerase, UDP-,galactowaldenase,SDR1E1,short chain dehydrogenase/reductase family 1E, member 1,UDP galactose-4-epimerase,UDP-galactose 4-epimerase,UDP-GalNAc 4-epimerase,UDP-GlcNAc 4-epimerase,UDP-g
Catalyzes two distinct but analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The reaction with UDP-Gal plays a critical role in the
Molecular Weight: 54.3 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 2582
UniProt: Q14376
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAA