CCBL1 Recombinant Protein, Human

Catalog Number: ASB-OPCA02231
Article Name: CCBL1 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02231
Supplier Catalog Number: OPCA02231
Alternative Catalog Number: ASB-OPCA02231-100UG,ASB-OPCA02231-1MG,ASB-OPCA02231-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: beta-lysase, kidney,CCBL1,cysteine conjugate beta lyase 1,cysteine conjugate-beta lyase, cytoplasmic,cysteine conjugate-beta lyase, cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase),cysteine-S-conjugate beta-lyase,glutamine transaminas
Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. Catalyzes the beta-elimination
Molecular Weight: 58.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 883
UniProt: Q16773
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSS