FGL2 Recombinant Protein, Human

Catalog Number: ASB-OPCA02246
Article Name: FGL2 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02246
Supplier Catalog Number: OPCA02246
Alternative Catalog Number: ASB-OPCA02246-100UG,ASB-OPCA02246-1MG,ASB-OPCA02246-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: fibrinogen-like protein 2,fibroleukin,pT49,T49.
May play a role in physiologic lymphocyte functions at mucosal sites.
Molecular Weight: 51.6 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 10875
UniProt: Q14314
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGN