SEPT7 Recombinant Protein, Human

Catalog Number: ASB-OPCA02249
Article Name: SEPT7 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02249
Supplier Catalog Number: OPCA02249
Alternative Catalog Number: ASB-OPCA02249-100UG,ASB-OPCA02249-1MG,ASB-OPCA02249-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: CDC10,CDC10 (cell division cycle 10, S. cerevisiae, homolog),CDC10 protein homolog,CDC3,NBLA02942,SEPT7,SEPT7A,septin 7 variant 4,septin-7.
Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Required for normal progress through mitosis. Involved in cytokinesis. Required for normal association of CENPE with the kinetochore. Plays a role in ciliog
Molecular Weight: 66.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 989
UniProt: Q16181
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTII