UGP2 Recombinant Protein, Human

Catalog Number: ASB-OPCA02250
Article Name: UGP2 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02250
Supplier Catalog Number: OPCA02250
Alternative Catalog Number: ASB-OPCA02250-100UG,ASB-OPCA02250-1MG,ASB-OPCA02250-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: DEE83,EIEE83,pHC379,SVUGP2,testis tissue sperm-binding protein Li 58p,UDPG,UDP-glucose diphosphorylase,UDP-glucose pyrophosphorylase,UDP-glucose pyrophosphorylase 1,UDPGP,UDPGP2,UGP1,UGPase 2,UGPP1,UGPP2,uridyl diphosphate glucose pyrophosphorylase 2,Uri
Plays a central role as a glucosyl donor in cellular metabolic pathways.
Molecular Weight: 71.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 7360
UniProt: Q16851
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILN