RBBP7 Recombinant Protein, Human

Catalog Number: ASB-OPCA02252
Article Name: RBBP7 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02252
Supplier Catalog Number: OPCA02252
Alternative Catalog Number: ASB-OPCA02252-100UG,ASB-OPCA02252-1MG,ASB-OPCA02252-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: G1/S transition control protein-binding protein RbAp46,histone acetyltransferase type B subunit 2,histone-binding protein RBBP7,nucleosome-remodeling factor subunit RBAP46,RbAp46,RBBP-7,retinoblastoma-binding protein 7,retinoblastoma-binding protein p46,
Core histone-binding subunit that may target chromatin remodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chr
Molecular Weight: 63.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 5931
UniProt: Q16576
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIW