COTL1 Recombinant Protein, Human

Catalog Number: ASB-OPCA02255
Article Name: COTL1 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02255
Supplier Catalog Number: OPCA02255
Alternative Catalog Number: ASB-OPCA02255-100UG,ASB-OPCA02255-1MG,ASB-OPCA02255-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: CLP,coactosin-like 1,coactosin-like protein,epididymis secretory sperm binding protein.
Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Acts as a chaperone for ALOX5 (5LO), influencing both its stability and activity in leukotrienes synthesis.
Molecular Weight: 31.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 23406
UniProt: Q14019
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE