GCKR Recombinant Protein, Human

Catalog Number: ASB-OPCA02256
Article Name: GCKR Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02256
Supplier Catalog Number: OPCA02256
Alternative Catalog Number: ASB-OPCA02256-100UG,ASB-OPCA02256-1MG,ASB-OPCA02256-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: FGQTL5,GKRP,glucokinase (hexokinase 4) regulator,glucokinase regulatory protein,hexokinase 4 regulator.
Inhibits glucokinase (GCK) by forming an inactive complex with this enzyme. The affinity of GCKR for GCK is modulated by fructose metabolites: GCKR with bound fructose 6-phosphate has increased affinity for GCK, while GCKR with bound fructose 1-phosphate
Molecular Weight: 84.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 2646
UniProt: Q14397
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEIFQEEGQALSTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDCCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGL