PLA2R1 Recombinant Protein, Human

Catalog Number: ASB-OPCA02261
Article Name: PLA2R1 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02261
Supplier Catalog Number: OPCA02261
Alternative Catalog Number: ASB-OPCA02261-100UG,ASB-OPCA02261-1MG,ASB-OPCA02261-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: 180 kDa secretory phospholipase A2 receptor,CLEC13C,C-type lectin domain family 13 member C,M-type receptor,phospholipase A2 receptor 1, 180kD,phospholipase A2 receptor 1, 180kDa,PLA2G1R,PLA2IR,PLA2R,PLA2-R,secretory phospholipase A2 receptor.
Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor p
Molecular Weight: 19.4 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 22925
UniProt: Q13018
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID