KIR2DS1 Recombinant Protein, Human

Catalog Number: ASB-OPCA02264
Article Name: KIR2DS1 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02264
Supplier Catalog Number: OPCA02264
Alternative Catalog Number: ASB-OPCA02264-100UG,ASB-OPCA02264-1MG,ASB-OPCA02264-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: CD158 antigen-like family member H,CD158a,CD158H,killer cell immunoglobulin-like receptor 2DS1,killer cell immunoglobulin-like receptor KIRDS1,killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1,killer-cell immunoglobulin-lik
Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.
Molecular Weight: 28.8 kDa
Tag: N-terminal 6xHis-tagged
NCBI: 3806
UniProt: Q14954
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH