SART3 Recombinant Protein, Human

Catalog Number: ASB-OPCA02266
Article Name: SART3 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02266
Supplier Catalog Number: OPCA02266
Alternative Catalog Number: ASB-OPCA02266-100UG,ASB-OPCA02266-1MG,ASB-OPCA02266-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: DSAP1,HIV-1 Tat-interacting protein of 110kDa,hSART-3,P100,p110,p110 nuclear RNA-binding protein,p110(nrb),PRP24 homolog,RP11-13G14,SART-3,squamous cell carcinoma antigen recognized by T cells 3,squamous cell carcinoma antigen recognized by T-cells 3,tat
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation (PubMed:12032085). Also binds U6atac snRNPs a
Molecular Weight: 49.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 9733
UniProt: Q15020
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQ