JOSD1 Recombinant Protein, Human

Catalog Number: ASB-OPCA02267
Article Name: JOSD1 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02267
Supplier Catalog Number: OPCA02267
Alternative Catalog Number: ASB-OPCA02267-100UG,ASB-OPCA02267-1MG,ASB-OPCA02267-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: dJ508I15.2,josephin domain-containing 1,josephin domain-containing protein 1,josephin-1.
Deubiquitinates monoubiquitinated probes (in vitro). When ubiquitinated, cleaves Lys-63-linked and Lys-48-linked poly-ubiquitin chains (in vitro), hence may act as a deubiquitinating enzyme. May increase macropinocytosis and suppress clathrin- and caveol
Molecular Weight: 39.2 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 9929
UniProt: Q15040
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV