PTPRR Recombinant Protein, Human
Catalog Number:
ASB-OPCA02268
- Images (0)
| Article Name: | PTPRR Recombinant Protein, Human |
| Biozol Catalog Number: | ASB-OPCA02268 |
| Supplier Catalog Number: | OPCA02268 |
| Alternative Catalog Number: | ASB-OPCA02268-100UG,ASB-OPCA02268-1MG,ASB-OPCA02268-20UG |
| Manufacturer: | Aviva |
| Host: | Human |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Molecular Weight: | 62.6 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | Q05B41 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MILHRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQKRRGSNVSLTLDMSSLGNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMITKLKEKNE |
Product Guarantee and Expert Support
