STK11 Recombinant Protein, Human

Catalog Number: ASB-OPCA02269
Article Name: STK11 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02269
Supplier Catalog Number: OPCA02269
Alternative Catalog Number: ASB-OPCA02269-100UG,ASB-OPCA02269-1MG,ASB-OPCA02269-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: hLKB1,liver kinase B1,LKB1,PJS,polarization-related protein LKB1,renal carcinoma antigen NY-REN-19,serine/threonine-protein kinase 11,serine/threonine-protein kinase LKB1,serine/threonine-protein kinase STK11.
Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts
Molecular Weight: 64.3 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 6794
UniProt: Q15831
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYP