TAF12 Recombinant Protein, Human

Catalog Number: ASB-OPCA02270
Article Name: TAF12 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02270
Supplier Catalog Number: OPCA02270
Alternative Catalog Number: ASB-OPCA02270-100UG,ASB-OPCA02270-1MG,ASB-OPCA02270-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa,TAF2J,TAFII20,TAFII20/TAFII15,TAFII-20/TAFII-15,TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD,transcription initiation factor TFIID 20/15 kDa
TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.
Molecular Weight: 33.9 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 6883
UniProt: Q16514
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK