NAALADL2 Recombinant Protein, Human

Catalog Number: ASB-OPCA02286
Article Name: NAALADL2 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02286
Supplier Catalog Number: OPCA02286
Alternative Catalog Number: ASB-OPCA02286-100UG,ASB-OPCA02286-1MG,ASB-OPCA02286-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: glutamate carboxypeptidase II-type non-peptidase homologue,inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2,NAALADase L2,N-acetylated alpha-linked acidic dipeptidase 2.
May be catalytically inactive.
Molecular Weight: 88.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 254827
UniProt: Q58DX5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GYYVHTNCPSDAPSSGTVDPQLYQEILKTIQAEDIKKSFRNLVQLYKNEDDMEISKKIKTQWTSLGLEDVQFVNYSVLLDLPGPSPSTVTLSSSGQCFHPNGQPCSEEARKDSSQDLLYSYAAYSAKGTLKAEVIDVSYGMADDLKRIRKIKNVTNQIALLKLGKLPLLYKLSSLEKAGFGGVLLYIDPCDLPKTVNPSHDTFMVSLNPGGDPSTPGYPSVDESFRQSRSNLTSLLVQPISAPLVAKLISSPKA