C11orf73 Recombinant Protein, Human

Product Overview

• Article Name: C11orf73 Recombinant Protein, Human
• Biozol Catalog Number: ASB-OPCA02287
• Supplier Catalog Number: OPCA02287
• Alternative Catalog Number: ASB-OPCA02287-100UG,ASB-OPCA02287-1MG,ASB-OPCA02287-20UG
• Manufacturer: Aviva
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Alternative Names: C11orf73,Hikeshi, heat shock protein nuclear import factor,HLD13,HSPC138,HSPC179,L7RN6,lethal, Chr 7, Rinchik 6,OPI10,protein Hikeshi.

Product Description

Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat

Product Properties

• Molecular Weight: 37.6 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• NCBI: 51501
• UniProt: Q53FT3
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT