SMUG1 Recombinant Protein, Human

Catalog Number: ASB-OPCA02288
Article Name: SMUG1 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02288
Supplier Catalog Number: OPCA02288
Alternative Catalog Number: ASB-OPCA02288-100UG,ASB-OPCA02288-1MG,ASB-OPCA02288-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: FDG,HMUDG,single-strand selective monofunctional uracil DNA glycosylase,UNG3.
Recognizes base lesions in the genome and initiates base excision DNA repair. Acts as a monofunctional DNA glycosylase specific for uracil (U) residues in DNA with a preference for single-stranded DNA substrates. The activity is greater toward mismatches
Molecular Weight: 35.6 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 23583
UniProt: Q53HV7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL