PDZD11 Recombinant Protein, Human
Catalog Number:
ASB-OPCA02289
- Images (0)
| Article Name: | PDZD11 Recombinant Protein, Human |
| Biozol Catalog Number: | ASB-OPCA02289 |
| Supplier Catalog Number: | OPCA02289 |
| Alternative Catalog Number: | ASB-OPCA02289-100UG,ASB-OPCA02289-1MG,ASB-OPCA02289-20UG |
| Manufacturer: | Aviva |
| Host: | Human |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | AIPP1,ATPase-interacting PDZ protein,PDZ domain-containing protein 11,PDZK11,PISP,plasma membrane calcium ATPase-interacting single-PDZ protein,PMCA-interacting single-PDZ protein. |
| Molecular Weight: | 32.1 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| NCBI: | 51248 |
| UniProt: | Q5EBL8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH |
Product Guarantee and Expert Support
