TBCEL Recombinant Protein, Human

Catalog Number: ASB-OPCA02296
Article Name: TBCEL Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02296
Supplier Catalog Number: OPCA02296
Alternative Catalog Number: ASB-OPCA02296-100UG,ASB-OPCA02296-1MG,ASB-OPCA02296-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: catastrophin,El,E-like,leucine rich repeat containing 35,leucine-rich repeat-containing protein 35,LRRC35,tubulin-specific chaperone cofactor E-like protein,tubulin-specific chaperone e-like.
Acts as a regulator of tubulin stability.
Molecular Weight: 64.2 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 219899
UniProt: Q5QJ74
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKL