NXNL2 Recombinant Protein, Human

Catalog Number: ASB-OPCA02299
Article Name: NXNL2 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02299
Supplier Catalog Number: OPCA02299
Alternative Catalog Number: ASB-OPCA02299-100UG,ASB-OPCA02299-1MG,ASB-OPCA02299-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: C9orf121,nucleoredoxin-like protein 2,RDCVF2,RdCVF2L,rod-derived cone viability factor 2.
May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons.
Molecular Weight: 30.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 158046
UniProt: Q5VZ03
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS