BEND3 Recombinant Protein, Human

Catalog Number: ASB-OPCA02302
Article Name: BEND3 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02302
Supplier Catalog Number: OPCA02302
Alternative Catalog Number: ASB-OPCA02302-100UG,ASB-OPCA02302-1MG,ASB-OPCA02302-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: BEN domain-containing protein 3,KIAA1553.
Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its
Molecular Weight: 42.5 kDa
Tag: N-terminal GST-tagged
NCBI: 57673
UniProt: Q5T5X7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD