SLC25A30 Recombinant Protein, Human

Catalog Number: ASB-OPCA02304
Article Name: SLC25A30 Recombinant Protein, Human
Biozol Catalog Number: ASB-OPCA02304
Supplier Catalog Number: OPCA02304
Alternative Catalog Number: ASB-OPCA02304-100UG,ASB-OPCA02304-1MG,ASB-OPCA02304-20UG
Manufacturer: Aviva
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: kidney mitochondrial carrier protein 1,KMCP1,Solute carrier family 25 member 30.
Probable transporter.
Molecular Weight: 48.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
NCBI: 253512
UniProt: Q5SVS4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQTWK